PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT4G31270.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family Trihelix
Protein Properties Length: 294aa    MW: 33369.4 Da    PI: 4.591
Description sequence-specific DNA binding transcription factors
Gene Model
Gene Model ID Type Source Coding Sequence
AT4G31270.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix32.22.7e-101997280
     trihelix  2 WtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcp 80
                 W  +  l+L++    +e + +++ +  ++W  + +++ +  ++r+ +qC+ kw++l  +y +ik++e++ + + +s ++
  AT4G31270.1 19 WAVKDCLVLVNEIAAVEADCSNALSSFQKWTMITENCNALDVSRNLNQCRRKWDSLMSDYNQIKKWESQYRGTGRSYWS 97
                 99999999************************************************************98777776776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF138371.1E-81895No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009506Cellular Componentplasmodesma
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000037anatomyshoot apex
PO:0000084anatomyplant sperm cell
PO:0000293anatomyguard cell
PO:0009005anatomyroot
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0020038anatomypetiole
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 294 aa     Download sequence    Send to blast
MEEGTSGSRR TRSQVAPEWA VKDCLVLVNE IAAVEADCSN ALSSFQKWTM ITENCNALDV  60
SRNLNQCRRK WDSLMSDYNQ IKKWESQYRG TGRSYWSLSS DKRKLLNLPG DIDIELFEAI  120
NAVVMIQDEK AGTESDSDPE AQDVVDLSAE LAFVGSKRSR QRTMVMKETK KEEPRTSRVQ  180
VNTREKPITT KATHQNKTMG EKKPVEDMST DEEEDETMNI EEDVEVMEAK LSYKIDLIHA  240
IVGRNLAKDN ETKDGVSMDD KLKSVRQQGD ELIGCLSEIV STLNRLHEVP QEIE
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1156161KRSRQR
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1453504880.0
Genevisible253543_at0.0
Expression AtlasAT4G31270-
AtGenExpressAT4G31270-
ATTED-IIAT4G31270-
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT4G31270.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT4G31270
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1186740.0AK118674.1 Arabidopsis thaliana At4g31270 mRNA for unknown protein, complete cds, clone: RAFL19-94-K08.
GenBankBT0052870.0BT005287.1 Arabidopsis thaliana At4g31270 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_194855.20.0sequence-specific DNA binding transcription factor
TrEMBLQ8GWR80.0Q8GWR8_ARATH; At4g31270
STRINGAT4G31270.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM121542328
Representative plantOGRP74821314
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Fernandez-Calvino L, et al.
    Arabidopsis plasmodesmal proteome.
    PLoS ONE, 2011. 6(4): p. e18880
    [PMID:21533090]
  3. Li Q, et al.
    Regulation of Active DNA Demethylation by a Methyl-CpG-Binding Domain Protein in Arabidopsis thaliana.
    PLoS Genet., 2015. 11(5): p. e1005210
    [PMID:25933434]